PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.004G159700.1
Common NameB456_004G159700, LOC105791621
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB_related
Protein Properties Length: 345aa    MW: 37902.7 Da    PI: 9.5745
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.004G159700.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding445.1e-1473117147
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                         r +WT++E+e++++a +++  + Wk+I + +g  +t  q++s+ qky
  Gorai.004G159700.1  73 RESWTEQEHEKFLEALQLFDRD-WKKIEAFVG-SKTVIQIRSHAQKY 117
                         789*****************77.*********.*************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466899.72E-1767123IPR009057Homeodomain-like
PROSITE profilePS5129415.8868122IPR017930Myb domain
TIGRFAMsTIGR015572.6E-1871120IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.607.0E-771123IPR009057Homeodomain-like
SMARTSM007172.4E-1172120IPR001005SANT/Myb domain
PfamPF002491.7E-1173117IPR001005SANT/Myb domain
CDDcd001678.15E-975118No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0046686Biological Processresponse to cadmium ion
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 345 aa     Download sequence    Send to blast
MVSVNPNPAQ GFYFFDPMNM GLPGVNSAPP ANTVAPPLHV PPPPATSGAG NTTVYTEDPS  60
KKIRKPYTIT KSRESWTEQE HEKFLEALQL FDRDWKKIEA FVGSKTVIQI RSHAQKYFLK  120
VQKNGTSEHV PPPRPKRKAA HPYPQKAPKT ASVVPQVAGP YQSSSALHEP GYTYRRHSSS  180
MPGNPIATAS LSSWSYNSVP PVTVSQVTKD DAVLAGPTIV HNSCYSSSSE STPRTWSFGE  240
TIDRGDHWKQ SRVLPDFAEV YSFIGSVFDP GTSGHLQKLK QMDPINLETV LLLMRNLSIN  300
LMSPDFEDHR RLLSTYDAGS EGIKLSSPYN DVHTRKSASA VPTA*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00423DAPTransfer from AT4G01280Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012475232.10.0PREDICTED: protein REVEILLE 5-like isoform X1
SwissprotC0SVG51e-110RVE5_ARATH; Protein REVEILLE 5
TrEMBLA0A0D2MZ160.0A0A0D2MZ16_G
STRINGPOPTR_0014s08520.11e-167(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM12902893
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G52660.22e-95MYB_related family protein
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]